Web Analysis for Vhyrpscfegnpsvgtpevdnsmqacrvtgycklgnh - vhyrpscfegnpsvgtpevdnsmqacrvtgycklgnh.site
2.50
Rating by CuteStat
vhyrpscfegnpsvgtpevdnsmqacrvtgycklgnh.site is 2 weeks 3 days old. It is a domain having site extension. This website is estimated worth of $ 8.94 and have a daily income of around $ 0.15. As no active threats were reported recently by users, vhyrpscfegnpsvgtpevdnsmqacrvtgycklgnh.site is SAFE to browse.
PageSpeed Score
0
Siteadvisor Rating
Not Applicable
Traffic Report
Daily Unique Visitors: | Not Applicable |
Daily Pageviews: | Not Applicable |
Estimated Valuation
Income Per Day: | $ 0.15 |
Estimated Worth: | $ 8.94 |
Search Engine Indexes
Google Indexed Pages: | Not Applicable |
Bing Indexed Pages: | Not Applicable |
Search Engine Backlinks
Google Backlinks: | Not Applicable |
Bing Backlinks: | Not Applicable |
Safety Information
Google Safe Browsing: | No Risk Issues |
Siteadvisor Rating: | Not Applicable |
WOT Trustworthiness: | Not Applicable |
WOT Child Safety: | Not Applicable |
Website Ranks & Scores
Alexa Rank: | Not Applicable |
Domain Authority: | Not Applicable |
Web Server Information
Page Resources Breakdown
Homepage Links Analysis
Website Inpage Analysis
H1 Headings: | Not Applicable | H2 Headings: | Not Applicable |
H3 Headings: | Not Applicable | H4 Headings: | Not Applicable |
H5 Headings: | Not Applicable | H6 Headings: | Not Applicable |
Total IFRAMEs: | Not Applicable | Total Images: | Not Applicable |
Google Adsense: | Not Applicable | Google Analytics: | Not Applicable |
Websites Hosted on Same IP (i.e. 162.251.85.12)
HTTP Header Analysis
HTTP/2 200
vary: Accept-Encoding
content-encoding: gzip
content-length: 900
content-type: text/html; charset=UTF-8
date: Wed, 17 Apr 2024 22:01:17 GMT
server: Apache
vary: Accept-Encoding
content-encoding: gzip
content-length: 900
content-type: text/html; charset=UTF-8
date: Wed, 17 Apr 2024 22:01:17 GMT
server: Apache
Domain Information
Domain Nameserver Information
Host | IP Address | Country | |
---|---|---|---|
ns1.md-58.webhostbox.net | 204.11.58.151 | United States of America | |
ns2.md-58.webhostbox.net | 204.11.58.151 | United States of America |
Full WHOIS Lookup
Domain Name: VHYRPSCFEGNPSVGTPEVDNSMQACRVTGYCKLGNH.SITE
Registry Domain ID: Not Available From Registry
Registrar WHOIS Server: whois.hostinger.com
Registrar URL: https://www.hostinger.com
Updated Date: 2024-04-16T12:54:16Z
Creation Date: 2024-04-16T12:53:30Z
Registrar Registration Expiration Date: 2025-04-16T23:59:59Z
Registrar: Hostinger Operations, UAB
Registrar IANA ID: H2712453
Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited
Registry Registrant ID: Not Available From Registry
Registrant Name: Domain Admin
Registrant Organization: Privacy Protect, LLC (PrivacyProtect.org)
Registrant Street: 10 Corporate Drive Note - All Postal Mails Rejected, visit Privacyprotect.org
Registrant City: Burlington
Registrant State/Province: MA
Registrant Postal Code: 01803
Registrant Country: US
Registrant Phone: +1.8022274003
Registrant Phone Ext:
Registrant Fax:
Registrant Fax Ext:
Registrant Email: contact@privacyprotect.org
Registry Admin ID: Not Available From Registry
Admin Name: Domain Admin
Admin Organization: Privacy Protect, LLC (PrivacyProtect.org)
Admin Street: 10 Corporate Drive Note - All Postal Mails Rejected, visit Privacyprotect.org
Admin City: Burlington
Admin State/Province: MA
Admin Postal Code: 01803
Admin Country: US
Admin Phone: +1.8022274003
Admin Phone Ext:
Admin Fax:
Admin Fax Ext:
Admin Email: contact@privacyprotect.org
Registry Tech ID: Not Available From Registry
Tech Name: Domain Admin
Tech Organization: Privacy Protect, LLC (PrivacyProtect.org)
Tech Street: 10 Corporate Drive Note - All Postal Mails Rejected, visit Privacyprotect.org
Tech City: Burlington
Tech State/Province: MA
Tech Postal Code: 01803
Tech Country: US
Tech Phone: +1.8022274003
Tech Phone Ext:
Tech Fax:
Tech Fax Ext:
Tech Email: contact@privacyprotect.org
Name Server: ns1.md-58.webhostbox.net
Name Server: ns2.md-58.webhostbox.net
DNSSEC: Unsigned
Registrar Abuse Contact Email: abuse@hostinger.com
Registrar Abuse Contact Phone: +37064503378
URL of the ICANN WHOIS Data Problem Reporting System: http://wdprs.internic.net/
>>> Last update of WHOIS database: 2024-04-17T22:01:19Z <<<
For more information on Whois status codes, please visit https://icann.org/epp
Registration Service Provided By: HOSTINGER.IN
PRIVACYPROTECT.ORG is providing privacy protection services to this domain name to
protect the owner from spam and phishing attacks. PrivacyProtect.org is not
responsible for any of the activities associated with this domain name. If you wish
to report any abuse concerning the usage of this domain name, you may do so at
http://privacyprotect.org/contact. We have a stringent abuse policy and any
complaint will be actioned within a short period of time.
The data in this whois database is provided to you for information purposes
only, that is, to assist you in obtaining information about or related to a
domain name registration record. We make this information available "as is",
and do not guarantee its accuracy. By submitting a whois query, you agree
that you will use this data only for lawful purposes and that, under no
circumstances will you use this data to:
(1) enable high volume, automated, electronic processes that stress or load
this whois database system providing you this information; or
(2) allow, enable, or otherwise support the transmission of mass unsolicited,
commercial advertising or solicitations via direct mail, electronic mail, or
by telephone.
The compilation, repackaging, dissemination or other use of this data is
expressly prohibited without prior written consent from us. The Registrar of
record is Hostinger Operations, UAB.
We reserve the right to modify these terms at any time.
By submitting this query, you agree to abide by these terms.
Registry Domain ID: Not Available From Registry
Registrar WHOIS Server: whois.hostinger.com
Registrar URL: https://www.hostinger.com
Updated Date: 2024-04-16T12:54:16Z
Creation Date: 2024-04-16T12:53:30Z
Registrar Registration Expiration Date: 2025-04-16T23:59:59Z
Registrar: Hostinger Operations, UAB
Registrar IANA ID: H2712453
Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited
Registry Registrant ID: Not Available From Registry
Registrant Name: Domain Admin
Registrant Organization: Privacy Protect, LLC (PrivacyProtect.org)
Registrant Street: 10 Corporate Drive Note - All Postal Mails Rejected, visit Privacyprotect.org
Registrant City: Burlington
Registrant State/Province: MA
Registrant Postal Code: 01803
Registrant Country: US
Registrant Phone: +1.8022274003
Registrant Phone Ext:
Registrant Fax:
Registrant Fax Ext:
Registrant Email: contact@privacyprotect.org
Registry Admin ID: Not Available From Registry
Admin Name: Domain Admin
Admin Organization: Privacy Protect, LLC (PrivacyProtect.org)
Admin Street: 10 Corporate Drive Note - All Postal Mails Rejected, visit Privacyprotect.org
Admin City: Burlington
Admin State/Province: MA
Admin Postal Code: 01803
Admin Country: US
Admin Phone: +1.8022274003
Admin Phone Ext:
Admin Fax:
Admin Fax Ext:
Admin Email: contact@privacyprotect.org
Registry Tech ID: Not Available From Registry
Tech Name: Domain Admin
Tech Organization: Privacy Protect, LLC (PrivacyProtect.org)
Tech Street: 10 Corporate Drive Note - All Postal Mails Rejected, visit Privacyprotect.org
Tech City: Burlington
Tech State/Province: MA
Tech Postal Code: 01803
Tech Country: US
Tech Phone: +1.8022274003
Tech Phone Ext:
Tech Fax:
Tech Fax Ext:
Tech Email: contact@privacyprotect.org
Name Server: ns1.md-58.webhostbox.net
Name Server: ns2.md-58.webhostbox.net
DNSSEC: Unsigned
Registrar Abuse Contact Email: abuse@hostinger.com
Registrar Abuse Contact Phone: +37064503378
URL of the ICANN WHOIS Data Problem Reporting System: http://wdprs.internic.net/
>>> Last update of WHOIS database: 2024-04-17T22:01:19Z <<<
For more information on Whois status codes, please visit https://icann.org/epp
Registration Service Provided By: HOSTINGER.IN
PRIVACYPROTECT.ORG is providing privacy protection services to this domain name to
protect the owner from spam and phishing attacks. PrivacyProtect.org is not
responsible for any of the activities associated with this domain name. If you wish
to report any abuse concerning the usage of this domain name, you may do so at
http://privacyprotect.org/contact. We have a stringent abuse policy and any
complaint will be actioned within a short period of time.
The data in this whois database is provided to you for information purposes
only, that is, to assist you in obtaining information about or related to a
domain name registration record. We make this information available "as is",
and do not guarantee its accuracy. By submitting a whois query, you agree
that you will use this data only for lawful purposes and that, under no
circumstances will you use this data to:
(1) enable high volume, automated, electronic processes that stress or load
this whois database system providing you this information; or
(2) allow, enable, or otherwise support the transmission of mass unsolicited,
commercial advertising or solicitations via direct mail, electronic mail, or
by telephone.
The compilation, repackaging, dissemination or other use of this data is
expressly prohibited without prior written consent from us. The Registrar of
record is Hostinger Operations, UAB.
We reserve the right to modify these terms at any time.
By submitting this query, you agree to abide by these terms.